Protein Info for HP15_1739 in Marinobacter adhaerens HP15

Annotation: membrane protein containing DUF6, transmembrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details PF00892: EamA" amino acids 11 to 138 (128 residues), 48.5 bits, see alignment E=5.1e-17 amino acids 146 to 274 (129 residues), 41.6 bits, see alignment E=7e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNK9 at UniProt or InterPro

Protein Sequence (292 amino acids)

>HP15_1739 membrane protein containing DUF6, transmembrane (Marinobacter adhaerens HP15)
MQTTRIKGLTIAALGVLFIVPDALLVKITSVDPVVFLFWRGLLLAISFFVISWARYRSRL
VPEIRKCGRKGLFCAGAFAISTLGFVVGMKNTAAGNVLVILNTAPVIAAVIAWAVWKETL
PLRTWVVILVCVTGATFMAVGEFGKGDPLGLLMAVVAATALASNLNVARSKPDSDMSVML
MFGALVLAGVAALLSGAQMPSARDFFFIALLCLVFLPTACILIQIGPRYIPAAEVSLMLL
LETVFGSFLVWLFLGEVPPKLSLVGGVIVFSALAVHGWTEVSRYRKARVAVD