Protein Info for PGA1_c01820 in Phaeobacter inhibens DSM 17395

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 224 to 251 (28 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details PF00892: EamA" amino acids 10 to 152 (143 residues), 29.2 bits, see alignment E=5.1e-11 amino acids 166 to 302 (137 residues), 42.3 bits, see alignment E=4.5e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVU9 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PGA1_c01820 Predicted permeases (Phaeobacter inhibens DSM 17395)
MSRVSPSVGTGIALSLVSLALLGIMPIISNLRPAVLGALPFAFALSVWQLIFALPCFAVE
YNRGTRGIFADVLLPRQRRRMAGLALFTGCLFGLSTYLYVLGVEQAGAANAAIAIQAYPL
FAILWESLFLKRRKTTTELTLTFLLLGALYYLGTDGTLRMSGLSPWFLLALGVPFLWSIA
HVIIKEELSATTITPIQVTLIRVAISSVFLAGLLGVALPSGMALGFAALLQPMAVLMGLV
YFLELIVWFYAVRHIDVSLASSITTPWPALTLALSVPLLGDRIEPRQIAVLVIVVACIYG
LTLAGLRRARQVNV