Protein Info for Psest_1817 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 170 to 201 (32 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 318 to 354 (37 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHY2 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psest_1817 hypothetical protein (Pseudomonas stutzeri RCH2)
MTSYKSMRSVCATLIFAYVALSCAAFYLGDLLFRSLAVIVGCVVFVLMIWWAPKKNIIVL
SSCWAVICLVAAINMVWSDHRSLFLVLIFFSCLGVSWAAFEFQLTKYLYEYVFIMFLALT
FFLVFLFGYGYKEFNVFLEGSSRNVYSALMLASAVGYVLSVIYRGEKPALFLIVLFVMLS
YPLYGRSAIFFSVVLLFSVLFFYYRKTLFFCLFCFVLFLVFSYIYFDGQIDGYARGTNFE
AGLESERFDMLADYFKGLDVNGVFFGGDFTVYPSIEAKGGNPHNAFLRLHGYWGVGISIL
LFLFFVSQILAVQDKRAMIAFTAFLILVRSFFDIVYLFNLFDYLFFPAILYFFYRPYYVG
NADVSRIGVGRDSNFSWGKQ