Protein Info for Psest_1810 in Pseudomonas stutzeri RCH2
Annotation: UDP-N-acetylglucosamine 4,6-dehydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to PSEB_CAMJE: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
KEGG orthology group: None (inferred from 89% identity to bpt:Bpet2302)MetaCyc: 59% identical to UDP-N-acetylglucosamine 4,6-dehydratase subunit (Helicobacter pylori 26695)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]
Predicted SEED Role
"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)
MetaCyc Pathways
- CMP-pseudaminate biosynthesis (6/6 steps found)
- UDP-N-acetyl-β-L-fucosamine biosynthesis (1/4 steps found)
- UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
- CMP-diacetamido-8-epilegionaminic acid biosynthesis (1/7 steps found)
- superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (9/24 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Nucleotide sugars metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Porphyrin and chlorophyll metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.-
Use Curated BLAST to search for 4.2.1.- or 4.2.1.115
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GK33 at UniProt or InterPro
Protein Sequence (332 amino acids)
>Psest_1810 UDP-N-acetylglucosamine 4,6-dehydratase (Pseudomonas stutzeri RCH2) MFSDKTILVTGGTGSFGNTFVPMTLARYNPKKIIIFSRDEMKQWDMAKKFEGDKRVRFFI GDVRDKDRLYRALDGVDYVVHAAATKIVPTAEYNPFECVKTNVDGAMNLIDACIDKGVKG VVALSTDKASSPINLYGATKLASDKLFVAGNSYSGEHGTRFSVVRYGNVMGSRGSVIPFF MSIKDKGVLPITDERMSRFMISLEEGVELVWHAFEDMEGGEIYVKKIPSMKVTDLARVVA PEARQEIIGIRPGEKLHEQMISAEDAYYTYEYPEHFKILPTIHSWSTCPKRIKDGKKVPE GFVYASDNNSEWMSDSQLQAWIDANREKIGSI