Protein Info for Psest_1810 in Pseudomonas stutzeri RCH2

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR03589: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)" amino acids 1 to 321 (321 residues), 546.1 bits, see alignment E=1.1e-168 PF05368: NmrA" amino acids 4 to 122 (119 residues), 34.5 bits, see alignment E=8.9e-12 PF00106: adh_short" amino acids 5 to 169 (165 residues), 26.8 bits, see alignment E=1.7e-09 PF08659: KR" amino acids 6 to 125 (120 residues), 24.1 bits, see alignment E=1.5e-08 PF04321: RmlD_sub_bind" amino acids 6 to 181 (176 residues), 30.5 bits, see alignment E=1e-10 PF02719: Polysacc_synt_2" amino acids 7 to 278 (272 residues), 324.7 bits, see alignment E=2.6e-100 PF01370: Epimerase" amino acids 7 to 223 (217 residues), 81.9 bits, see alignment E=2.5e-26 PF01073: 3Beta_HSD" amino acids 8 to 129 (122 residues), 62.5 bits, see alignment E=1.7e-20 PF16363: GDP_Man_Dehyd" amino acids 8 to 127 (120 residues), 48.1 bits, see alignment E=5.9e-16 PF13460: NAD_binding_10" amino acids 11 to 130 (120 residues), 37 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 61% identical to PSEB_CAMJE: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 89% identity to bpt:Bpet2302)

MetaCyc: 59% identical to UDP-N-acetylglucosamine 4,6-dehydratase subunit (Helicobacter pylori 26695)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK33 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Psest_1810 UDP-N-acetylglucosamine 4,6-dehydratase (Pseudomonas stutzeri RCH2)
MFSDKTILVTGGTGSFGNTFVPMTLARYNPKKIIIFSRDEMKQWDMAKKFEGDKRVRFFI
GDVRDKDRLYRALDGVDYVVHAAATKIVPTAEYNPFECVKTNVDGAMNLIDACIDKGVKG
VVALSTDKASSPINLYGATKLASDKLFVAGNSYSGEHGTRFSVVRYGNVMGSRGSVIPFF
MSIKDKGVLPITDERMSRFMISLEEGVELVWHAFEDMEGGEIYVKKIPSMKVTDLARVVA
PEARQEIIGIRPGEKLHEQMISAEDAYYTYEYPEHFKILPTIHSWSTCPKRIKDGKKVPE
GFVYASDNNSEWMSDSQLQAWIDANREKIGSI