Protein Info for PGA1_c01810 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF00392: GntR" amino acids 16 to 78 (63 residues), 48.2 bits, see alignment E=6.9e-17 PF00155: Aminotran_1_2" amino acids 102 to 452 (351 residues), 74.7 bits, see alignment E=8.1e-25

Best Hits

Predicted SEED Role

"Transcriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWW2 at UniProt or InterPro

Protein Sequence (470 amino acids)

>PGA1_c01810 putative transcriptional regulator, GntR family (Phaeobacter inhibens DSM 17395)
MAIWLPNLNGRSGPKYLQIVEAMAEDIASGRLAPGAQLPPHRELAYQIGVSANTTSRAYA
EAVTRALLRGEVGRGSFVRAAEPMMHQGGAANSLHRNSLGPIDLSRNLPLAGFSQPHIRQ
ALHTLAEGSDLSPLLDYQSDADLDRHIDAWQHWLAYCGVDAIRSEVMTTVGGQHALFCAV
AGVLKAGDLLLTEALTYMPVQAMAERLGVTTAAVAMDPQGVQPEAFEALCRHARPRAFYL
TPTLQAPTTVTLDDERRAEIAEIAMRHDVILIEDDVFAPLKPDRPAPLATHAPDHTIYVA
SLSKSVAPGLRVGILKAPQRLMPALRHAANLSLWMAPPLTAEIGARLILDGTAETLAEQQ
RRAAQHRQTLARSVLSPPGATPMSYQADPQGLHLWLPLPPDLRADVFRAQCAQSEVLVSE
GRSFALAPRDAPEAVRLCLSHEVSEDRLTTGLQRVAHLLRESRKSHALQI