Protein Info for Psest_1808 in Pseudomonas stutzeri RCH2

Annotation: Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF00753: Lactamase_B" amino acids 29 to 220 (192 residues), 42.7 bits, see alignment E=1.3e-14 PF10996: Beta-Casp" amino acids 319 to 433 (115 residues), 104.8 bits, see alignment E=9e-34 PF07521: RMMBL" amino acids 451 to 505 (55 residues), 42.6 bits, see alignment 1e-14

Best Hits

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLZ6 at UniProt or InterPro

Protein Sequence (517 amino acids)

>Psest_1808 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain (Pseudomonas stutzeri RCH2)
MRYPDIEHHGAKDGVTGSCHQLHMDASHSLLVDCGLFQGNETSSDGRAATGRLDIEFSLR
TVQALVVTHVHIDHVGRIPYLLAAGYKGPIYCSEPSAKLLPIVLEDAFKLGFSRDQKAVE
RYLKLVEQRLRPLPYQRWSTLLETEELIARVRLQRAGHILGSAYVEIDLTYPTSGESQRI
VFSGDLGAAHAPLLMPPESPERADILVLESTYGDRLHEDRTSRRQRLEAVIEHALQDQGT
VLIPAFSIGRTQELLYELEEIIHSKQQVSTDQSSLPADERARGGIESAGAPHSHSPLSSE
ERARVERNSDNAHGQLETDWPRLPIILDSPLATRFTEAYRSLQPYWNQEARERVEGGRNP
LAFDNLIMIDSHADHIAVVNHLTQTARPAIVIAGNGMCSGGRIVNYLKAMLHDPRHDVLF
VGYQAQGTPGQAIQQYGPKGGYVDLDGERFDIRARVTSIGGYSAHADQKGLVEFVTGMRE
WPTKIGVVHGEHGARQALIKVLQQRYYAAGNALVVKS