Protein Info for Psest_1806 in Pseudomonas stutzeri RCH2

Annotation: Chain length determinant protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details PF02706: Wzz" amino acids 11 to 74 (64 residues), 56.3 bits, see alignment E=3.4e-19 PF13807: GNVR" amino acids 375 to 412 (38 residues), 32 bits, see alignment 9.3e-12

Best Hits

KEGG orthology group: None (inferred from 48% identity to pfs:PFLU2909)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKN7 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Psest_1806 Chain length determinant protein (Pseudomonas stutzeri RCH2)
MIVQQPTSPNDEIDLVELSRALWRQKILVVSITLLVTLLAALYAFLATPYFQARTYLRPV
PQSNLDQLNETGIYKLTPEEAINRVAGGLSSYDNRLEFFMNNQELFPNLTERGEQSEQAF
AEFNEEAFEMLFPDPKRTENRSAFVGLRLTYPEGVAGASVVNGFVAYVLELERREIAEDV
ESLVNNRLASLEMNIEAQRANYEASKEAKIASLLEEDALKRAQLQDELAALREELKTRRN
NRIQELTEAISIAESLSIRKPTSPSAMSDSARGGAQVIRTEVNSRETPLYFMGTEALSAE
RDALASRKSDDFMEPRIAEIQSELAMLENNREVEILREREGEDLYLTNLAELREEAARLK
GIKLDTDRLRLVRLDQPALDSSKPIKPRKALILALGFVLGGMLGVFAALVRSLANRGREL
QASSGS