Protein Info for Psest_1805 in Pseudomonas stutzeri RCH2

Annotation: integration host factor, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 TIGR00988: integration host factor, beta subunit" amino acids 1 to 93 (93 residues), 173.5 bits, see alignment E=4.4e-56 PF00216: Bac_DNA_binding" amino acids 1 to 91 (91 residues), 104 bits, see alignment E=4.1e-34 PF18291: HU-HIG" amino acids 3 to 91 (89 residues), 34.8 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 96% identical to IHFB_PSEPG: Integration host factor subunit beta (ihfB) from Pseudomonas putida (strain GB-1)

KEGG orthology group: K05788, integration host factor subunit beta (inferred from 92% identity to pae:PA3161)

Predicted SEED Role

"Integration host factor beta subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK28 at UniProt or InterPro

Protein Sequence (94 amino acids)

>Psest_1805 integration host factor, beta subunit (Pseudomonas stutzeri RCH2)
MTKSELIERIVTQQGLLSSKDVELAIKTMLEQMAQALATGDRIEIRGFGSFSLHYRAPRV
GRNPKTGQSVSLDGKFVPHFKPGKELRDRVNEED