Protein Info for Psest_1801 in Pseudomonas stutzeri RCH2

Annotation: 3-deoxy-7-phosphoheptulonate synthase, class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 87 to 107 (21 residues), see Phobius details PF01474: DAHP_synth_2" amino acids 5 to 440 (436 residues), 713.1 bits, see alignment E=5.1e-219 TIGR01358: 3-deoxy-7-phosphoheptulonate synthase" amino acids 5 to 446 (442 residues), 730.8 bits, see alignment E=2.3e-224

Best Hits

Swiss-Prot: 61% identical to AROF_ARATH: Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic (DHS1) from Arabidopsis thaliana

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 96% identity to psa:PST_2510)

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase II (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKN2 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Psest_1801 3-deoxy-7-phosphoheptulonate synthase, class II (Pseudomonas stutzeri RCH2)
MNDAWSPDSWRSKPIQQQPEYPDAEHLSRVERTLAGLPPLVFAGEARELRRQFAEVTQGR
AFLLQGGDCAESFAEFSATKIRDTFKVLLQMAIVMTFAAGCPVVKVGRMAGQFAKPRSAG
DETVDGVTLPAYRGDIVNGIDFNAQSRVPDPERLLQAYHQSTSSLNLLRAFAQGGFADLH
QVHQWNLDFIANSLLAEKYHQLGARIDETLKFMRACGLDGAPQLRETSFFTAHEALLLNY
EQAFVRQDSLSGGWYDCSAHMLWIGDRTRQLDGAHVEFLRGVGNPIGVKVGPSMDSEELI
RLIDILNPQNDPGRLNLIVRMGADKVEAGLPRLVRAVQNEGRHVLWSSDPMHGNTIKASS
GYKTRDFEKVLAEVRQFFDVHRAEGSYPGGIHIEMTGQNVTECIGGSRPITEAGLSDRYH
TQCDPRLNADQSLEMAFMIAETLKQLRPN