Protein Info for Psest_1800 in Pseudomonas stutzeri RCH2

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 117 to 143 (27 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 419 to 442 (24 residues), see Phobius details amino acids 457 to 480 (24 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 24 to 471 (448 residues), 245.1 bits, see alignment E=1.7e-76 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 34 to 473 (440 residues), 312.9 bits, see alignment E=1.7e-97 PF03600: CitMHS" amino acids 53 to 417 (365 residues), 179.5 bits, see alignment E=9.7e-57

Best Hits

KEGG orthology group: K14445, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2/3/5 (inferred from 86% identity to psa:PST_2511)

Predicted SEED Role

"di- and tricarboxylate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK22 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Psest_1800 anion transporter (Pseudomonas stutzeri RCH2)
MSDSPQNKGAAIAASIGLFLGPLLLLLCILTEPPADLSRTAWLTVGMAALMAVWWSTEAI
PIPATSLLPILLIPVLGIDTLAKATAPYANPTIFLFLGGFLLGLAMQRWNLHKRIALATL
LAVGSAPSRQIAGFMIATAFISMWVSNTATSIMMLPIGLSVISLLVAGSDKRDGERFAIA
LLLGIAYAASVGGIATLIGTPPNALLAAFLRENYDVHIGFGQWMLLGLPVSLGMLLFIWW
WLTRGGFTLSGGDSRAMLEKEMAALGPMSKAEKMVAVVFSLAALAWIFQPLLAKHVNGVN
DTSIAMAAALSLFLIPVDLRQRVFLMDWEQANKAPWGVLLLFGGGLSLAGVIGASGLAQW
IAQSLGGFGALPLILMIGLVALVITFLTEITSNTATAAAFLPLLGALAVAQGLSPEMLAI
PAAIAASCAFMMPVATPPNAIVFGTGQMHIQSMIKAGFAINLFGVALVTLLCYGLVGLIW
AS