Protein Info for Psest_1795 in Pseudomonas stutzeri RCH2

Annotation: Flagellar motor component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details PF01618: MotA_ExbB" amino acids 101 to 220 (120 residues), 86.4 bits, see alignment E=6.9e-29

Best Hits

Swiss-Prot: 32% identical to YTXD_BACME: Uncharacterized 29.3 kDa protein in ccpA 3'region (ytxD) from Bacillus megaterium

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 96% identity to psa:PST_2516)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKM6 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Psest_1795 Flagellar motor component (Pseudomonas stutzeri RCH2)
MNPSTLIGILASIGLLAVVMLFAAKEPALFIDLPSLGIVLVGTLAATFISYPLREVTRVF
GLLWTVLRNERLYTRQDLDELVHISRLWISGDLVAVEKAEEKVSNPFLRTGVQLVIDNTP
EEDILEVLQWRIARLRARENAEAQLFRAMASYAPAFGMIGTLVGLINLMFMLGSGDMDLI
GRSLAIALMTTFYGVLLANLILKPVAVKLERRTEQRVALMNLVMQGISMMCNRRSPAYMR
ETLKSFIAHHDDEIRDGIPAAPPGKPQEE