Protein Info for HP15_1715 in Marinobacter adhaerens HP15

Annotation: phospholipase/carboxylesterase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02230: Abhydrolase_2
  • amino acids 12 to 182 (171 residues), 152.5 bits, E=3.9e-48
• PF01738: DLH
  • amino acids 50 to 166 (117 residues), 24.4 bits, E=5.1e-09
• PF00756: Esterase
  • amino acids 72 to 111 (40 residues), 24.4 bits, 5.8e-09

Best Hits

Swiss-Prot: 43% identical to EST1_PSEFL: Carboxylesterase 1 (estA) from Pseudomonas fluorescens

KEGG orthology group: K01044, carboxylesterase [EC: 3.1.1.1] (inferred from 61% identity to maq:Maqu_3288)

Predicted SEED Role

No annotation

MetaCyc Pathways

• methylsalicylate degradation (2/2 steps found)
• aspartame degradation (1/2 steps found)
• methyl indole-3-acetate interconversion (1/2 steps found)
• superpathway of methylsalicylate metabolism (1/5 steps found)
• retinol biosynthesis (2/7 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Drug metabolism - other enzymes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

See E4PN30 at UniProt or InterPro

Protein Sequence (184 amino acids)

>HP15_1715 phospholipase/carboxylesterase family protein (Marinobacter adhaerens HP15)
MPELGLPEDTAVRFIFPHAPNLPVTINGGMSMPAWYDIKAMDIDRVVDTEQLRASADAVA
KLVEQQKQKGIPPERIIIAGFSQGGAVAYELGLSYPERFGGVLALSTYFATADTVQRSEA
NADVPISVYHGTFDPMVPESLGVRSVETLKEMGYDPSYQTFPMEHSVCLEEIQDIGRFIR
RHLL