Protein Info for HP15_1711 in Marinobacter adhaerens HP15

Annotation: glucose-1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 15 to 388 (374 residues), 519.7 bits, see alignment E=2e-160 PF12804: NTP_transf_3" amino acids 17 to 160 (144 residues), 29.8 bits, see alignment E=6.3e-11 PF00483: NTP_transferase" amino acids 17 to 280 (264 residues), 217.6 bits, see alignment E=2.1e-68

Best Hits

Swiss-Prot: 70% identical to GLGC_NITOC: Glucose-1-phosphate adenylyltransferase (glgC) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 89% identity to maq:Maqu_1433)

MetaCyc: 57% identical to glucose-1-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate adenylyltransferase. [EC: 2.7.7.27]

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PN26 at UniProt or InterPro

Protein Sequence (421 amino acids)

>HP15_1711 glucose-1-phosphate adenylyltransferase (Marinobacter adhaerens HP15)
MQTAKRFVSRLTRQTLALVLAGGRGSRLHDLTKWRAKPAVPFGGKFRIIDFPLSNCINSG
IGQVGVITQYKSHSLIRHIQRGWGFLRGELDEFVELLPAQQRIETSWYEGTADAVLQNLD
IIRSHQPEYVLILAGDHVYKMDYGTMLAHHVENDADITVGCIEVPLDEASAFGVMSVDDE
LRVTEFVEKPEQPKPMPGQPGKALASMGIYVFSTQVLFDELMRDQQMDGESSHDFGKDII
PSVIKRLRVVAFPFRNPVENKPAYWRDVGTVDALWQANLELIGISPELNLYDSHWPIWTY
QEQLPPAKFVFDDDNRRGMAVDSMVAGGCIVSGALVKHSLLFSQVKIHSYSEISDSVIYP
DVEIGRHCHIRNALIDRGCRIPEGTRIGFDEADDRKRFHVSPKGIVLITPEMLGQDYPHG
L