Protein Info for Psest_1787 in Pseudomonas stutzeri RCH2

Annotation: high affinity sulphate transporter 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 401 to 432 (32 residues), see Phobius details TIGR00815: sulfate permease" amino acids 10 to 558 (549 residues), 444.9 bits, see alignment E=2e-137 PF00916: Sulfate_transp" amino acids 25 to 406 (382 residues), 336.7 bits, see alignment E=1.6e-104 PF01740: STAS" amino acids 458 to 563 (106 residues), 51.6 bits, see alignment E=7.1e-18

Best Hits

KEGG orthology group: None (inferred from 86% identity to psa:PST_2524)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLX5 at UniProt or InterPro

Protein Sequence (592 amino acids)

>Psest_1787 high affinity sulphate transporter 1 (Pseudomonas stutzeri RCH2)
MMKRLARLLPCLEWAKQYDRAAAAKDSLAALIVTLMLIPQSLAYAMLAGLPPVTGLYASM
LPLIAYTLFGTSRTLAVGPVAVVSLMTAAALGPLFAAGSAEYVGAAMLLAMLSGVVLVVM
AVLRLGFLANFLSHPVISGFISASGILIALGQLKHILGISVAGENALELAAGLIAGLPQT
HLPTLAIGLTSLVFLYLVRGHLAKWLHGLGMSPRMAATLSKIGPVAALFLAIAAVSVFQL
AELGVRVVGEVPRGLPSLGLPSLDLALAMQLLPAAVLISLVGFVESVSVAQTLAAKRRER
IEPNQELVALGGANVAAALSGGFPVTGGFARSVVNFDAGAQTPLAGALTAAGIGLTVLFF
TPLFHNLPHAVLAATIIVAVLSLVDLAALRRTWRYSRQDAAAMAATMLGVLLVGVESGII
LGVGLSLLLFLWRTSQPHVAVVGQLPGSEHFRNIERFAVVQSPTVLSVRVDESLYFPNAR
FLEDRIAELVGRYPQAEHLVLMCPGVNLIDASALESLEAITARLHAAGVQLHLSEVKGPV
MDRLRRSDFLEHFGGQVFLSQYEALLSLDPQTTHRAVERQRDHLSSMQENAG