Protein Info for PGA1_c17720 in Phaeobacter inhibens DSM 17395

Annotation: putative phage cell wall peptidase, NlpC/P60 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR02219: putative phage cell wall peptidase, NlpC/P60 family" amino acids 5 to 141 (137 residues), 175.4 bits, see alignment E=3.7e-56 PF00877: NLPC_P60" amino acids 14 to 134 (121 residues), 30.9 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: None (inferred from 67% identity to dsh:Dshi_2164)

Predicted SEED Role

"Gene Transfer Agent NlpC/P60 family peptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXC0 at UniProt or InterPro

Protein Sequence (149 amino acids)

>PGA1_c17720 putative phage cell wall peptidase, NlpC/P60 family (Phaeobacter inhibens DSM 17395)
MRAQLVAAARGWLGTPYVHQAARRGAGCDCLGLIRGLWREVYGQEPEAVPGYTMDWSEPQ
GEEALWQAALRHLSPRPLEDARAGDVILFRMRRGAVAKHIALQTETGTMPRFIHAYSGHG
VIENALSQPWHRRIVARFSFPDVDADEVT