Protein Info for HP15_1705 in Marinobacter adhaerens HP15

Annotation: potassium uptake protein, TrkH family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 26 to 53 (28 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 348 to 371 (24 residues), see Phobius details amino acids 416 to 437 (22 residues), see Phobius details amino acids 478 to 503 (26 residues), see Phobius details PF02386: TrkH" amino acids 87 to 499 (413 residues), 204.2 bits, see alignment E=1.5e-64

Best Hits

KEGG orthology group: None (inferred from 89% identity to maq:Maqu_1427)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PN20 at UniProt or InterPro

Protein Sequence (505 amino acids)

>HP15_1705 potassium uptake protein, TrkH family (Marinobacter adhaerens HP15)
MRKADPTGILTPSPGISWLEHPLRNLYPVIFIVSVMFVLLSIFMTLPVILLAGSEAPNAM
AFAESAAIVWGLGILGMAATYRKPRDLKPRYMFVLTVSSWFIIALFSSLPFYLSDLGISA
ADAFFEGTSGITTTGATVLSGLDDMDRDLLIWRSILQWIGGIGIIGMFVAVLPFLRVGGM
RLFATESSEWTDKALPRMKTLSRGLLVVYLAFSIIAVVTYWFSGMTLFDAFNHGLTSIAT
GGFSTSDLSMGKFNDLILMEATFFMIIGSLPFFLFVREMHGQHGVLFRDQQVRLFLAILF
FVPLLLTLYRWMVSPVPFDPIHNYASTLFNVTSVVTTTGYASEDYSAWGPLAFVLFFFLM
FVGGCSGSTAGGMKIFRFQLSLIILREQLMRLLHPRAVLTRNYNGRAVSDEIISSMIAYT
FIFLLCLLLITVALAAMQLDFVTALSGALTSLTNVGPGLGDIIGPAGNFGPLPDAAKWVL
SVGMLMGRLEILSVVIVLSPAFWRS