Protein Info for Psest_1782 in Pseudomonas stutzeri RCH2

Annotation: Predicted transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF01022: HTH_5" amino acids 26 to 71 (46 residues), 51.8 bits, see alignment E=9.1e-18 PF01638: HxlR" amino acids 30 to 73 (44 residues), 24 bits, see alignment E=4.3e-09

Best Hits

Swiss-Prot: 52% identical to BIGR_AGRFC: Biofilm growth-associated repressor (bigR) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 97% identity to psa:PST_2528)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLX1 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Psest_1782 Predicted transcriptional regulators (Pseudomonas stutzeri RCH2)
MTPELDIEQLRANAASAGALLKALANPDRLLLLCQLSQGERNVTELEQLLGIQQPTLSQQ
LAVLRREGLVATRREGKQIYYRISSSEALAVITTLYQLFCERGQQ