Protein Info for Psest_1772 in Pseudomonas stutzeri RCH2

Annotation: Aspartate/tyrosine/aromatic aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF00155: Aminotran_1_2" amino acids 34 to 394 (361 residues), 177.9 bits, see alignment E=3.4e-56 PF01041: DegT_DnrJ_EryC1" amino acids 108 to 206 (99 residues), 26.4 bits, see alignment E=4e-10

Best Hits

Swiss-Prot: 73% identical to ALAA_ECOL6: Glutamate-pyruvate aminotransferase AlaA (alaA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K14260, alanine-synthesizing transaminase [EC: 2.6.1.2 2.6.1.66] (inferred from 99% identity to psa:PST_2537)

MetaCyc: 73% identical to glutamate--pyruvate aminotransferase AlaA (Escherichia coli K-12 substr. MG1655)
Alanine transaminase. [EC: 2.6.1.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.66

Use Curated BLAST to search for 2.6.1.2 or 2.6.1.66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJZ4 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Psest_1772 Aspartate/tyrosine/aromatic aminotransferase (Pseudomonas stutzeri RCH2)
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAIMQYYQQKQVEGVSIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLADIKAKITPNTKALVLINPNNPT
GAVYPKEVLEGMVELARQHKLVLFSDEIYDKILYDDAVHISTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKHKAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTWELLNDIPGISCVKPMGALYAFPRIDPKICPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGNFLKTYQQ