Protein Info for Psest_1769 in Pseudomonas stutzeri RCH2

Annotation: Protein of unknown function (DUF2959).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF11172: DUF2959" amino acids 21 to 210 (190 residues), 279.5 bits, see alignment E=9.2e-88

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_2540)

Predicted SEED Role

"ATPase involved in DNA repair"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHT9 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Psest_1769 Protein of unknown function (DUF2959). (Pseudomonas stutzeri RCH2)
MRRFIIACCALLALSGCQSAYYSAMEKAGIHKRDILVTRVEDARDSQQEAKQQFKDALER
YRSVVEVKGGDLEKRYEALNREYEASVASARDVRTRIEAVEDVADALFKEWENELKQYSN
ASLKAASAKELSGTRAEYRTLLQRMKAAEKRIEPVLSVLRDQVLFLKHNLNARAISALHG
EYRTLQGNVDQLMAEMQRAIDEADTFIRRLQADNRS