Protein Info for Psest_0174 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03695: UPF0149" amino acids 10 to 172 (163 residues), 128 bits, see alignment E=2.5e-41

Best Hits

Swiss-Prot: 78% identical to Y324_PSEMY: UPF0149 protein Pmen_0324 (Pmen_0324) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K09895, hypothetical protein (inferred from 97% identity to psa:PST_4071)

Predicted SEED Role

"FIG001590: Putative conserved exported protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH87 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Psest_0174 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MSIQNSPYAAFATLLAGSPQTVSPAELHGLLLGRSCAGAGFEVEPWLTDASDLLGEAPQD
NIRQALIGLQEMVKGELAGDDIAVVLLLPSDDAPLAERAVALGQWCQGFLAGFGLAAGDR
ALSSEAMEVLQDLSAIAQIQDSLEESEDGETDYMEVMEYLRVAPLLLFTECAKPLPAAAK
PSLH