Protein Info for Psest_1767 in Pseudomonas stutzeri RCH2

Annotation: Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF06490: FleQ" amino acids 4 to 116 (113 residues), 29.4 bits, see alignment E=3.4e-10 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 98.2 bits, see alignment E=1.3e-31 PF00158: Sigma54_activat" amino acids 135 to 296 (162 residues), 233.8 bits, see alignment E=3.9e-73 PF14532: Sigma54_activ_2" amino acids 145 to 300 (156 residues), 60.3 bits, see alignment E=1e-19 PF07728: AAA_5" amino acids 154 to 272 (119 residues), 25.9 bits, see alignment E=3.6e-09 PF25601: AAA_lid_14" amino acids 302 to 372 (71 residues), 66.3 bits, see alignment E=7e-22 PF02954: HTH_8" amino acids 411 to 450 (40 residues), 43.4 bits, see alignment 8.8e-15

Best Hits

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 76% identity to pfs:PFLU4441)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJZ0 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Psest_1767 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Pseudomonas stutzeri RCH2)
MAAKILLVEDDRALREALGITLELGGYAYRAVDSAEAALSALQQDMFSLVVSDVNMPGMD
GHELLALIRKRYPQIPVLLMTAFGAVARAVDAMREGAIDYLVKPFEPNTLLELLRRHING
ALDAADAEGPVACDASSQQLLGLARRVAQSDSTVLIFGESGTGKEVLARYIHQQSPRSKR
PFIAINCAAIPDNMLEATLFGHEKGAFTGAIASQPGKFEQADGGTLLLDEISEMPLGLQA
KLLRVLQEREVERVGGRRPITLDIRVLATTNRDLVGEVAAGRFREDLYYRLSVFPLSWSP
LRQRPADILPLAERLLASRARKMRQGSAQLSAAAQRCLLGHPWPGNVRELDNAIQRALIL
QQGGLIQPEDLCLSGVSNVASLPTPVAVAQTPSDLITEGPRESCSALGDDLRRREFQLII
DTLRAERGRRKETADRLGISARTLRYKLAQMRDAGMDVEAALYTS