Protein Info for Psest_1765 in Pseudomonas stutzeri RCH2

Annotation: Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF06490: FleQ" amino acids 6 to 122 (117 residues), 99.1 bits, see alignment E=5.7e-32 PF00158: Sigma54_activat" amino acids 146 to 313 (168 residues), 258 bits, see alignment E=1e-80 PF14532: Sigma54_activ_2" amino acids 147 to 317 (171 residues), 67.1 bits, see alignment E=6.3e-22 PF07728: AAA_5" amino acids 170 to 288 (119 residues), 31.9 bits, see alignment E=3.8e-11 PF25601: AAA_lid_14" amino acids 318 to 399 (82 residues), 79.1 bits, see alignment E=5.3e-26 PF02954: HTH_8" amino acids 439 to 478 (40 residues), 44.4 bits, see alignment 3.2e-15

Best Hits

KEGG orthology group: K10941, sigma-54 specific transcriptional regulator, flagellar regulatory protein A (inferred from 96% identity to psa:PST_2544)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLV5 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Psest_1765 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Pseudomonas stutzeri RCH2)
MWRETKILLIDDDRDRRRDLTVILNFLSEDHLACSSDEWQDAVAGLESSRVVNGVMLGNV
SSRGGAAELIKQMGKWDENVPLLLIGEPAPADWPDDVRRRVLTSLEMPPSYNKLLDSLHR
AQIYREMYDQAKSRGRQREPNLFRSLVGTSRAVQHVRQMMEQVADTEASVLILGESGTGK
EVVARNLHYHSKRRQGPFVPVNCGAIPAELLESELFGHEKGAFTGAITARSGRFELAEGG
TLFLDEIGDMPLPMQVKLLRVLQERTFERVGSNRTQNADVRIIAATHKDLEKMIEEGTFR
EDLYYRLNVFPIEMAPLRERVEDIPLLMNELISRMEHEKRGSIRFNSAAIMSLCRHDWPG
NVRELANLVERMAIMHPYGVIGVMELPKKFRHVDDDDEQYATSLHDEMEERAAISAPMVV
PEAQAMLPVEGLDLKEYLGNLEQGLIHQALEDAGGVVARAAERLRIRRTTLVEKMRKYGM
NRRDDDMGE