Protein Info for PGA1_c17490 in Phaeobacter inhibens DSM 17395

Annotation: hemolysin-type calcium-binding repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF00353: HemolysinCabind" amino acids 120 to 151 (32 residues), 29.6 bits, see alignment (E = 2.7e-11) amino acids 209 to 242 (34 residues), 32.2 bits, see alignment (E = 4.1e-12) amino acids 229 to 260 (32 residues), 22.9 bits, see alignment (E = 3.4e-09) amino acids 262 to 291 (30 residues), 30.6 bits, see alignment (E = 1.3e-11) amino acids 298 to 330 (33 residues), 30.6 bits, see alignment (E = 1.3e-11) amino acids 324 to 357 (34 residues), 34.1 bits, see alignment (E = 1.1e-12) amino acids 331 to 366 (36 residues), 33.2 bits, see alignment 2e-12 amino acids 359 to 393 (35 residues), 40.4 bits, see alignment 1.1e-14 amino acids 394 to 428 (35 residues), 30.8 bits, see alignment 1.1e-11

Best Hits

Predicted SEED Role

"allergen V5/TPX-1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E150 at UniProt or InterPro

Protein Sequence (498 amino acids)

>PGA1_c17490 hemolysin-type calcium-binding repeat-containing protein (Phaeobacter inhibens DSM 17395)
MAELLVTAASNVAPPFDFSDFDFTKVAVLSATDTQIAVQYGAFVMVFQGSFSFDESGNLS
PDSPLNGFGLFYDQSLIMSVSGFTLPSQMIADGDLYALLAVALSGDDIITSAWNGGERIT
GFAGNDTIRAGDGDDTIFGGAGQDELVLGDGVHTYSFAFDDSAGALLTTTKGRDMLFNVE
TVRLANQTLRIQEGSATDEALLSTNVDDTNRSDMIHGRGGDDTITGGAGRDFLLGGAGED
RLSGGKNDDFLDGGLDDDHLSGNAGDDNLRGSLGNDTLIGGAGNDTLRGDNDVGPDDNAD
DLLIGGSGHDSLDGNAGNDTLKAGNGADTLHGGAGDDILNGGRGRDLITGDDGRDTLAGG
RANDTLTGGAGNDRLSGGAGHDVMRGDAGNDLLIGGRGHDTLFGSDGADRLIGQSGHDRL
TGGSGGDSFVFARGSGRDTITDFQLGEDLIQITRGADRIDHLGFAQLGADVRITFANVSI
LVEDVTVDQLMNTDNFLF