Protein Info for Psest_1761 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein involved in biosynthesis of c-type cytochromes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 105 to 126 (22 residues), see Phobius details PF03918: CcmH" amino acids 9 to 152 (144 residues), 188.1 bits, see alignment E=2.4e-60

Best Hits

Swiss-Prot: 59% identical to CCMH_PSEAE: Cytochrome c-type biogenesis protein CcmH (ccmH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 94% identity to psa:PST_2548)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLP6 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Psest_1761 Uncharacterized protein involved in biosynthesis of c-type cytochromes (Pseudomonas stutzeri RCH2)
MKRLIHGMLLGLFLATTAQAAIDTYEFRDEAERERYRTLTEELRCPKCQNQNIADSNAPI
AMDLRQEIFRMLEEGQNNDQIINYLVDRYGDFVRYNPPVNAKTLLLWYGPAGLLVLGFGV
LTMILVRRRRVEKAPASNTLSETERERLAQLLDKKDS