Protein Info for Psest_1754 in Pseudomonas stutzeri RCH2

Annotation: heme ABC exporter, ATP-binding protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 6 to 206 (201 residues), 268.5 bits, see alignment E=1.6e-84 PF00005: ABC_tran" amino acids 22 to 161 (140 residues), 111.4 bits, see alignment E=5.2e-36

Best Hits

Swiss-Prot: 82% identical to CCMA_PSEAE: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 94% identity to psa:PST_2555)

MetaCyc: 54% identical to cytochrome c maturation protein A (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHS6 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Psest_1754 heme ABC exporter, ATP-binding protein CcmA (Pseudomonas stutzeri RCH2)
MSTPFLEAVALACERDWRLLFDKLDLRLESGEMLQISGPNGSGKTSLLRLLCGLMQPTAG
EVLLNGQSLNAQRGELARNLLWIGHAAGIKGLLTAEENLTWLCALHQPTNREAIWHALAE
VGLRGFEDVPCHTLSAGQQRRVGLARLYLSPPPLWILDEPFTALDKHGVAQLERHLAAHC
EQGGLVVLTTHHSLTEKPAGYRELDLGQRAA