Protein Info for Psest_1735 in Pseudomonas stutzeri RCH2

Annotation: flagellar biosynthetic protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details PF01312: Bac_export_2" amino acids 9 to 348 (340 residues), 435.6 bits, see alignment E=6.9e-135 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 9 to 354 (346 residues), 407.9 bits, see alignment E=1.9e-126

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 98% identity to psa:PST_2574)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U3GK50 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Psest_1735 flagellar biosynthetic protein FlhB (Pseudomonas stutzeri RCH2)
MAESESGADKSEEPTEKRLRESREKGQLARSRELSTVAVTLGGIGGLLASGGSLAQTLMA
MMQGTFELSRETLLDEGSMVRLLMGSGLMALEAIMPLLIALLIASIVGPVSLGGWLFSAK
AMAPKVSRMNPAAGLKRMFSTKALVELLKALGKFLVVLGVALLVLSAYQDDLLSIAKQPL
DLAIMHSAEIVGWCALWMACGLIVIAAVDVPFQLWDNKQKLMMTKQEVKDEYKDSEGKPE
VKSRIRQLQREAAQRRMMQAVPEADVVITNPTHFAVALKYDGDKGGAPRLVAKGGDFVAL
KIREIAQEHKVTVLESPALARAVYYSTELDQEIPAGLYLAVAQVLAYVYQLRQYRAGKGR
RPDPLNDVPIPPDLRRDE