Protein Info for HP15_1652 in Marinobacter adhaerens HP15

Annotation: disulfide isomerase/thiol-disulfide oxidase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 118 to 160 (43 residues), 24.4 bits, see alignment 2.9e-09 PF13098: Thioredoxin_2" amino acids 121 to 254 (134 residues), 34 bits, see alignment E=3.2e-12

Best Hits

Swiss-Prot: 36% identical to DSBG_PSEAE: Thiol:disulfide interchange protein DsbG (dsbG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03805, thiol:disulfide interchange protein DsbG (inferred from 43% identity to tbd:Tbd_2787)

MetaCyc: 35% identical to protein sulfenic acid reductase and chaperone DsbG (Escherichia coli K-12 substr. MG1655)
Protein disulfide-isomerase. [EC: 5.3.4.1]; RXN-20019 [EC: 5.3.4.1]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 5.3.4.1

Use Curated BLAST to search for 5.3.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMW7 at UniProt or InterPro

Protein Sequence (255 amino acids)

>HP15_1652 disulfide isomerase/thiol-disulfide oxidase-like protein (Marinobacter adhaerens HP15)
MDKKISGLAAVISAAFLFSATAHGSGSHAPIIKQVTDRGLKVVSSFEAIDGMTGYILDSN
GSPVTLYVTQDGEHAFVGTLIDKKGLNLSAPRVQELFHDAKNQQAWAELENSHWIQDGDP
NAETVVYAFVDPNCPYCHRFRTAALPWINEGKVQIRHIVVGVLASDSIAKASTILGSNRP
HGAYIKNFETFRSGGIVPVHAASERGKAQVEANNRLMSNLGVSATPGIYYKDSTGNVKMR
LGLPPESELNRILNP