Protein Info for Psest_1712 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 852 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details transmembrane" amino acids 259 to 282 (24 residues), see Phobius details PF05228: CHASE4" amino acids 64 to 225 (162 residues), 81 bits, see alignment E=2.8e-26 TIGR00229: PAS domain S-box protein" amino acids 308 to 426 (119 residues), 53.3 bits, see alignment E=3e-18 PF00989: PAS" amino acids 312 to 416 (105 residues), 25.4 bits, see alignment E=3.6e-09 PF13188: PAS_8" amino acids 312 to 362 (51 residues), 26.2 bits, see alignment 1.7e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 428 to 588 (161 residues), 140.4 bits, see alignment E=4.6e-45 PF00990: GGDEF" amino acids 432 to 586 (155 residues), 161.3 bits, see alignment E=5e-51 PF00563: EAL" amino acids 607 to 838 (232 residues), 247.4 bits, see alignment E=4e-77

Best Hits

KEGG orthology group: None (inferred from 83% identity to psa:PST_2597)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJS7 at UniProt or InterPro

Protein Sequence (852 amino acids)

>Psest_1712 PAS domain S-box/diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MHAPSNGNGPMKPKARTLFARRILPSMVALLVAALVAAALALINIARHIDRDALAQSQFL
ASKALQAQHDWMNRSIVDYAFWGDAYRHLNGQPDTDWAYTQANLGPSLYKDFDYEAVLVI
NPDGETAYSVVRGKLQPVDSREYLQGGLPELLARARTAVEEDAGVSSLLWSEGQPALVAA
AVLSTGGANVEEIDGPSSILLFVDLLDAARLEEIGAQYAIEHLRLAGGLAPLDGPSIAQT
MENGSAIHFTWTAPQPGRLLLWVTLPILAAVALGLGLLAWLLMRHALRSMHLLDVSYARL
AASRSALAESEERFRDVAEAASDWIWETDDQARLTFLSNRFRQITGHEPREWLGRPLLEL
LISDSAALHSWLEAPEITPLRSSYRAADGCERFCRLAARSIQHDGKLVGYRGTASDVTEE
TKAQARVQYLSQHDPLTGLPNRSRLRDYLEQNLASLRSGSTMTLLYIDLDRFKPVNDTLG
HAAGDEVLMGVASRLRERTRDGDLVARLGGDEFVVALHRMSEDEDIDRLCNRIIEALSSP
FAYENHQISIGASIGVALAPMDATQANELLRCADIALYQAKDAGRGTWRAYGRDMDQRLH
ERLRREEQLRVAIAEQHLEVHYQPRYLSQGMRIIGAEALVRWHHPTHGLLLPEQFIPLAE
ETGLIIPLGRWVLQQACQQAATWPVDMVVSVNLSPLQLHDDRLLDEISQALHENGLAGER
LELEITESALLQETQSTLDLLKRIKALGVHLAVDDFGTGYSSLTSLRHYPFDVIKIDNSF
VAGIEQSMEDHSIVRALIELGRGLQMRVTAEGVETEEQLRLLTDDGCTEVQGFHMSLPMP
AEELRRLLAGAG