Protein Info for PGA1_c01710 in Phaeobacter inhibens DSM 17395

Annotation: 50S ribosomal protein L24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 TIGR01079: ribosomal protein uL24" amino acids 3 to 101 (99 residues), 102.4 bits, see alignment E=8.1e-34 PF00467: KOW" amino acids 7 to 38 (32 residues), 31.9 bits, see alignment E=8.2e-12 PF17136: ribosomal_L24" amino acids 40 to 101 (62 residues), 66.8 bits, see alignment E=1.8e-22

Best Hits

Swiss-Prot: 93% identical to RL24_RUEPO: 50S ribosomal protein L24 (rplX) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02895, large subunit ribosomal protein L24 (inferred from 93% identity to sil:SPO0496)

Predicted SEED Role

"LSU ribosomal protein L24p (L26e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWV0 at UniProt or InterPro

Protein Sequence (103 amino acids)

>PGA1_c01710 50S ribosomal protein L24 (Phaeobacter inhibens DSM 17395)
MAAKLRKGDKVVVLAGKDKGKEGTIASVDPKAGKAIVDGVNMAIRHTRQTQSDQGGRLPK
ALPIQLSNLALLDANGKATRVGFRMEGDKKVRFAKTTGDVIDA