Protein Info for HP15_1625 in Marinobacter adhaerens HP15

Annotation: 3-oxoacyl-(acyl carrier protein) synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 4 to 321 (318 residues), 459.4 bits, see alignment E=2.9e-142 PF00108: Thiolase_N" amino acids 37 to 150 (114 residues), 33.9 bits, see alignment E=4.5e-12 PF08545: ACP_syn_III" amino acids 107 to 184 (78 residues), 116.9 bits, see alignment E=5.9e-38 PF08541: ACP_syn_III_C" amino acids 233 to 322 (90 residues), 123.3 bits, see alignment E=7.5e-40

Best Hits

Swiss-Prot: 86% identical to FABH_MARHV: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 86% identity to maq:Maqu_1374)

MetaCyc: 60% identical to 3-oxoacyl-[acyl carrier protein] synthase 3 (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-acetyltransferase. [EC: 2.3.1.38]; Beta-ketoacyl-acyl-carrier-protein synthase III. [EC: 2.3.1.38, 2.3.1.180]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PM61 at UniProt or InterPro

Protein Sequence (322 amino acids)

>HP15_1625 3-oxoacyl-(acyl carrier protein) synthase III (Marinobacter adhaerens HP15)
MTFARITGTGSYLPENIVTNKDLEKMVDTTDQWIRERTGIERRHIAVEGQTTVDLAEQAA
RNAIDAAGINAQDIDLIVFATSTPDKIFPSSACILQARLGIHGCPAFDIQAVCSGFVYAL
ATAEKFIKTGSSKKALVIGAEVFSRIINWEDRGTCVLFGDGAGAVILEADEETGILSTHI
HADGQYEDLLHVPCGISDNYDQVKAGRAFVEMKGNEVFKVAVNTLGKIVDETLAANRMQK
SEIDWLVPHQANLRIISATAKKLNMSMDQVVVTVNEHGNTSAASIPLALDVAVRDGRIKR
NEVLLLEAFGGGFTWGSALLRY