Protein Info for PGA1_c16830 in Phaeobacter inhibens DSM 17395

Annotation: xanthine phosphoribosyltransferase Gpt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 14 to 159 (146 residues), 92 bits, E=1.2e-30

Best Hits

Swiss-Prot: 93% identical to XGPT_RUEPO: Xanthine phosphoribosyltransferase (gpt) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00769, xanthine phosphoribosyltransferase [EC: 2.4.2.22] (inferred from 93% identity to sil:SPO2143)

Predicted SEED Role

"Xanthine-guanine phosphoribosyltransferase (EC 2.4.2.22)" in subsystem Purine conversions (EC 2.4.2.22)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.22

Sequence Analysis Tools

See I7E104 at UniProt or InterPro

Protein Sequence (167 amino acids)

>PGA1_c16830 xanthine phosphoribosyltransferase Gpt (Phaeobacter inhibens DSM 17395)
MTDRLPHEKGFHISWDQLHRDSRALAWRLDGQGPDNGAWRAVVAITRGGMAPAMIVSREL
DIRIVDTIGVKSYHHQDQGQAEVLKAPDAELMGDGEGVLIIDDLVDSGKTLELVRQMYPK
AHFATVYAKPKGRPMVDTFITEVSQDTWIFFPWDMALQYVEPYRGTD