Protein Info for Psest_1691 in Pseudomonas stutzeri RCH2

Annotation: aminodeoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR03461: aminodeoxychorismate lyase" amino acids 5 to 263 (259 residues), 285.5 bits, see alignment E=1.7e-89 PF01063: Aminotran_4" amino acids 26 to 247 (222 residues), 168.8 bits, see alignment E=8.6e-54

Best Hits

Swiss-Prot: 39% identical to PABC_ECOLI: Aminodeoxychorismate lyase (pabC) from Escherichia coli (strain K12)

KEGG orthology group: K02619, 4-amino-4-deoxychorismate lyase [EC: 4.1.3.38] (inferred from 80% identity to psa:PST_2619)

MetaCyc: 39% identical to aminodeoxychorismate lyase (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate lyase. [EC: 4.1.3.38]

Predicted SEED Role

"Aminodeoxychorismate lyase (EC 4.1.3.38)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 4.1.3.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJQ5 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Psest_1691 aminodeoxychorismate lyase (Pseudomonas stutzeri RCH2)
MTSSWLNGQPCIGLPVHDRGLAYGDGLFETIRVADSQAPLLDRHLQRLRDGCQRLAIPID
TDELRNELARFFPVLGRGVAKLIVTRGTGQRGYAPPEPCQPQRLLLGSPLPAYPPQNALA
GIRLFPCETRLAEQPRLAGIKHLNRLEQVLARAEWHDPAYAEGLMRDMSGRVVEGVFSNL
FMVVDGELRTASLVRCGVAGVMRAEIMARASQHGRTVVESDISYAELLQADEVFLCNSLY
GIWPVTALAERVWPVGPLTRKLQAVVADLLSDP