Protein Info for HP15_1611 in Marinobacter adhaerens HP15

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF13673: Acetyltransf_10" amino acids 138 to 199 (62 residues), 28.2 bits, see alignment E=3.5e-10 PF13508: Acetyltransf_7" amino acids 139 to 192 (54 residues), 33.2 bits, see alignment E=1.1e-11 PF00583: Acetyltransf_1" amino acids 140 to 191 (52 residues), 26.9 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: None (inferred from 81% identity to maq:Maqu_1358)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PM47 at UniProt or InterPro

Protein Sequence (223 amino acids)

>HP15_1611 GCN5-related N-acetyltransferase (Marinobacter adhaerens HP15)
MSNGSDNKNKSEPAIVRLDETARNEARSILFHAYRNEPTFQYLFDHRRPGYDQRVRATIR
ELIDLYFELEQDAIGVMVDDTLVAVAFIGDPELRMNLADQISWRIRMVLTTGFASTRRYL
DYHEKIRDMLPQPLAHQLPMMGVNPKYQNRGYGRLLLKTVEKLCAENPRGSGLVLDTGNN
RYLPFYESEGFRSLGKIQLGDFEDHVLFREVHPETKTATSGQT