Protein Info for Psest_1686 in Pseudomonas stutzeri RCH2

Annotation: fatty acid/phospholipid synthesis protein PlsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00182: fatty acid/phospholipid synthesis protein PlsX
  • amino acids 1 to 321 (321 residues), 319.9 bits, E=9.7e-100
• PF02504: FA_synthesis
  • amino acids 1 to 312 (312 residues), 325 bits, E=5e-101
• PF01515: PTA_PTB
  • amino acids 74 to 206 (133 residues), 38.1 bits, E=1.3e-13

Best Hits

Swiss-Prot: 86% identical to PLSX_PSEU5: Phosphate acyltransferase (plsX) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 86% identity to psa:PST_2624)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• anandamide biosynthesis I (3/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

See L0GJQ0 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Psest_1686 fatty acid/phospholipid synthesis protein PlsX (Pseudomonas stutzeri RCH2)
MGGDFGPHCIVPASLSCLVENSSLHLVLVGQVSLLEQLVAQHPGIDRSRLKIVDAPETIG
MDERPAQALRGKPRSSMRVALEQVRDGKAKACVSAGNTGALMALARQILKTLPGIDRPAM
VTALPTQGSPCLLLDLGANVDCPADQLYQFAVMGVVAAESLGLDQPRVALLNVGTEEIKG
TQQVKQAAVLLQQAPDINYRGFIEGDGLYRGEADVVVCDGFVGNVLLKSSEGLAGMLVAK
VEALFRRSLGARIVGAMALPLLRRLRAELNPAQYNGASFLGLQGIVVKSHGGAGADGFKA
AVRRAAEDVEHDLPGQLARRLGHYLGGSRPSVAGDDVTAADGEPSN