Protein Info for Psest_1684 in Pseudomonas stutzeri RCH2

Annotation: Predicted metal-binding, possibly nucleic acid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF02620: YceD" amino acids 64 to 170 (107 residues), 76 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 34% identical to YCED_HAEIN: Large ribosomal RNA subunit accumulation protein YceD (yceD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07040, uncharacterized protein (inferred from 94% identity to psa:PST_2626)

Predicted SEED Role

"COG1399 protein, clustered with ribosomal protein L32p"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLM8 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Psest_1684 Predicted metal-binding, possibly nucleic acid-binding protein (Pseudomonas stutzeri RCH2)
MLKGPIPPHVDPRKLADRAATLAGELPLSRLKRLTDPLEGDQGAVRASFTFGRDEQRTAV
IHSELDVEVKMICQRCLEPVVLPIHSECDYAVVNEGASSQHLPKGYDVLEVGEDPLDLLA
LVEDELLLALPIVPLHAPEICQPPVGPDEPEPSEDEVTRSNPFSVLAQLKRDPNV