Protein Info for HP15_1605 in Marinobacter adhaerens HP15

Annotation: general secretion pathway protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF07963: N_methyl" amino acids 4 to 29 (26 residues), 31.5 bits, see alignment 9.1e-12 TIGR01708: type II secretion system protein H" amino acids 6 to 155 (150 residues), 82.1 bits, see alignment E=3.7e-27 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 7 to 30 (24 residues), 29.3 bits, see alignment (E = 5.4e-11) PF12019: GspH" amino acids 46 to 154 (109 residues), 29.5 bits, see alignment E=9e-11

Best Hits

KEGG orthology group: K02457, general secretion pathway protein H (inferred from 77% identity to maq:Maqu_1352)

Predicted SEED Role

"General secretion pathway protein H"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PM41 at UniProt or InterPro

Protein Sequence (176 amino acids)

>HP15_1605 general secretion pathway protein H (Marinobacter adhaerens HP15)
MQVRSRQTGFTLIEILVVLVVVGLLASLAVFTMGGSSQQRELENEVRELYLLMQTASEQA
VLNNLELGLKLEEDGYQFVAYQDQTGDWKASGERMFRARSLPEWLTVTEFIESDAPRLAS
SEDTLLPDVVFFSSGETTPFELEFTIGNGSDTMHVLASDGVSPMEWRKPGDEGSSG