Protein Info for Psest_1682 in Pseudomonas stutzeri RCH2

Annotation: Periplasmic serine proteases (ClpP class)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 41 to 62 (22 residues), see Phobius details PF00574: CLP_protease" amino acids 88 to 164 (77 residues), 21.4 bits, see alignment E=2e-08 PF01343: Peptidase_S49" amino acids 142 to 282 (141 residues), 108.2 bits, see alignment E=4.1e-35

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 92% identity to psa:PST_2628)

Predicted SEED Role

"Periplasmic serine proteases (ClpP class)"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKC0 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Psest_1682 Periplasmic serine proteases (ClpP class) (Pseudomonas stutzeri RCH2)
MSDEWKAPVDESKEDRNSWKLLEKTLLAGVQEQRRARRWGIFFKLLTFVYLFGALALFSP
ALQFGKSKGAQESHTAVINVRGMIADEESASADNIVGALRAAFENANTKGVVLRINSPGG
SPVQSGYIYDEIRRLRGEYPAIKVYAVITDLGASGAYYIASAADEIYADKSSLVGSIGVT
AATFGFVDTMAKLGVERRVYTAGEHKAFLDPFQPEKPEESQFWRGVLATTHQQFIEAVKR
GRGDRLQDAQHPELFSGLVWSGEQALELGLIDGLGSTAHVAREVIGEPEMVDFTIKESPL
DRFTKKLGAGVAERLAILVGLQGPALR