Protein Info for Psest_1669 in Pseudomonas stutzeri RCH2

Annotation: lipoprotein releasing system, transmembrane protein, LolC/E family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 22 to 48 (27 residues), see Phobius details amino acids 272 to 297 (26 residues), see Phobius details amino acids 317 to 344 (28 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 5 to 415 (411 residues), 501.3 bits, see alignment E=1.1e-154 PF12704: MacB_PCD" amino acids 28 to 243 (216 residues), 48.3 bits, see alignment E=1.6e-16 PF02687: FtsX" amino acids 276 to 408 (133 residues), 62.1 bits, see alignment E=5.4e-21

Best Hits

Swiss-Prot: 45% identical to LOLC_XYLFT: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 94% identity to psa:PST_2641)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLL4 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Psest_1669 lipoprotein releasing system, transmembrane protein, LolC/E family (Pseudomonas stutzeri RCH2)
MMFRPLSVFIGSRYTRAKRRNHFISFISLTSLIGLALGVLAMIMVLSVMNGFQREMSARI
LGMVPHATVIGDQPLDDWQAVAARLSAHSQIVGMAPVTQLEGMLSFKGSMQPIQISGIDP
QAEAQVSILGERLVGGSLDQLKPGEFGVIIGLMTVRRFGLKLGDKLTLIVPEVSSTPGGV
TPRMQRLNVVGVFKVGADLDGSLGMIHRADAAQIHRWAPEQVQGVRLKLSDLYRAPEVAA
QVGATLGDGYRVEDWSYTQGSLFSAMKMEKTMIGLLLMLIVAVAAFNIIATLIMVVADKR
ADIAILRTLGATPRQIMAIFMVQGSIIGFSGTVIGVVLGVLGALNVSELVNWLEKVSGQH
IFSSDVYFISTLPSELRLEDVVLVSVAALSLSFLATLYPAWRAAQTQPAEALRYE