Protein Info for Psest_1667 in Pseudomonas stutzeri RCH2

Annotation: lipoprotein releasing system, transmembrane protein, LolC/E family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 317 to 343 (27 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 4 to 415 (412 residues), 537.4 bits, see alignment E=1.2e-165 PF12704: MacB_PCD" amino acids 27 to 223 (197 residues), 60.8 bits, see alignment E=2.4e-20 PF02687: FtsX" amino acids 275 to 408 (134 residues), 60.6 bits, see alignment E=1.6e-20

Best Hits

Swiss-Prot: 44% identical to LOLC_NEIMA: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 97% identity to psa:PST_2644)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKA4 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Psest_1667 lipoprotein releasing system, transmembrane protein, LolC/E family (Pseudomonas stutzeri RCH2)
MFRPLSVYIGARYTRARRRSLFVSFISLTSMIGLALGVLVMIVVLSVMNGFDHEMRTRVL
GMVPHATIESPTPINDWQSLGARLEGHPQVSASAPFIQSQGLLTHQGQVTKILINAVDPK
AERQVSIIDQFFREGSLDDLAAGDFGIVIGDKAAAKLGVGVGDKITFVAPEVTVTPAGMF
PRMKRFTVTGIFHVGAGEIDGYVALANIADMARLQRWQPDQVQGLRLRFDDLFQAPRIAW
ELAGQLGDDFYSRDWTRTHGNLYQAIRMEKAMIGLLLLLIVAVAAFNIISTLVMVVTDKR
GDIAILRTLGATPQQIMAIFMVQGTVIGVVGTLVGALLGMFAAVNVSSWIAALERLIGHK
FLSADVYFIDYLPSQLMAADVIQVCVAALVLSFLATLYPAWRAARTQPAEALRYE