Protein Info for Psest_1655 in Pseudomonas stutzeri RCH2

Annotation: NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF05896: NQRA_N" amino acids 2 to 95 (94 residues), 122.1 bits, see alignment E=1.4e-39 TIGR01936: NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit" amino acids 2 to 445 (444 residues), 619.4 bits, see alignment E=1.9e-190 PF24836: NQRA_2nd" amino acids 113 to 255 (143 residues), 204.1 bits, see alignment E=1.7e-64 PF11973: NQRA_SLBB" amino acids 260 to 309 (50 residues), 71.8 bits, see alignment 8e-24

Best Hits

Swiss-Prot: 78% identical to NQRA_PSEAE: Na(+)-translocating NADH-quinone reductase subunit A (nqrA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00346, Na+-transporting NADH:ubiquinone oxidoreductase subunit A [EC: 1.6.5.-] (inferred from 94% identity to psa:PST_2655)

MetaCyc: 57% identical to Na(+)-translocating NADH-quinone reductase subunit A (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit A (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLD4 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Psest_1655 NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit (Pseudomonas stutzeri RCH2)
MINIKRGLDLPIAGAPAQRIEAGRPVRSVAVVGFDYPTMKPTMAVQVGDRVKLGQILFSD
KKSDGVHYTSPGAGVVSAVHRGEKRVLQSVVIDLDGDEEITFASYSPAQLDGLSSEQVRE
NLQQSGLWTALRTRPFSKVPAVDATPASIFVTAIDTHPLAADPAVIIAEQAEAFEAGLKV
LANLAKVFLCKAPSASLSGESLAKVQVESFSGPHPAGLAGTHIHFLDPVSASKSVWTIGY
QDVIAVGKLFTSGRLSVERVVSLAGPVVEKPRLVRTRLGANLDELTAGELQPGANRVVSG
SLLGGRTAHGAFAYLGRYHQQVSCLREGKEREMLHYMRPGVEKHSILNIYISKLMAGKKF
AFSTSTNGSPRAMVPVGNYEEVMPLDVLPTQLLRALIVGDTEVAQKLGCLELDEEDLALC
SYVCAGKYEYGPILRDNLTRIEKEG