Protein Info for HP15_1573 in Marinobacter adhaerens HP15

Annotation: formate dehydrogenase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 PF01257: 2Fe-2S_thioredx" amino acids 40 to 172 (133 residues), 87.9 bits, see alignment E=1.2e-28 PF01512: Complex1_51K" amino acids 215 to 376 (162 residues), 143.3 bits, see alignment E=1.2e-45 PF10531: SLBB" amino acids 400 to 449 (50 residues), 31.4 bits, see alignment 2.7e-11 PF10589: NADH_4Fe-4S" amino acids 488 to 563 (76 residues), 85.1 bits, see alignment E=5.1e-28

Best Hits

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 76% identity to csa:Csal_0996)

Predicted SEED Role

"tungsten-containing formate dehydrogenase beta subunit" in subsystem Formate hydrogenase

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PM09 at UniProt or InterPro

Protein Sequence (571 amino acids)

>HP15_1573 formate dehydrogenase, beta subunit (Marinobacter adhaerens HP15)
MKTDEQKVKRRRSGLRGRQLEPTVLSGLRELIGDERVDSSLRHRDRLIEHLHLIQDADGY
LSMARLRALASFMNLPMADVYETATFYAHFDVVHDEQTPPPAITLRVCDSLSCQLAGASA
LHKTLADGTDPAQVRVVHAPCMGRCDTAPVVAVGHHHVGNATAETVGAAVEQQQVQPDEI
HWQKLADYRSAGGYQLLKDCREGRVTVDSLAEELEHAGLRGLGGAGFPTYRKWQAVRAEP
GPRYAVINADEGEPGTFKDRYYLEREPHGFLEGALVSAWAVEAQALYIYLRDEYPGLLVV
LKDAIAELETAGIVEPGFVILRRGAGAYICGEESALIESLEGKPGKPRHRPPFVAQKGLF
GQPTLVNNVETVYWIPRIHAQGAEWYASQGRHGRKGLRSFSVSGRVARPGVHVAPAGVTL
NELIEEYCGGMAEGHRLVAYLPGGASGGILPASKADIPLDFDTLQEHGCFIGSAAVIVLS
DQDDLQAAAANLLGFFADESCGQCTPCRVGTEKMLTLLERDTWDEQTLQQLAAVMADASI
CGLGQAAPNPVLSLLRDFRSELASQNLIAKG