Protein Info for HP15_1572 in Marinobacter adhaerens HP15

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 141 to 160 (20 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details amino acids 213 to 237 (25 residues), see Phobius details amino acids 279 to 305 (27 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 168 to 383 (216 residues), 219.5 bits, see alignment E=3.1e-69 PF02405: MlaE" amino acids 172 to 381 (210 residues), 233 bits, see alignment E=1.5e-73

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 77% identity to maq:Maqu_1197)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLC8 at UniProt or InterPro

Protein Sequence (388 amino acids)

>HP15_1572 ABC transporter, permease protein (Marinobacter adhaerens HP15)
MPSPDSSEQTNPQQPTSSPGSVSVEAGTLSVNGDWLLSHYRSLSSLASSMSSRDLIKLSI
NLSGLTRIDTAGASQLASLIGPERLLEAASADSELPRETSALIAAVCEAMKNQPEADRRS
PSLVWSFVTGTGQKVESIFRLLWILVGFIGQTLGTLAWNLPRPWRWRMTPFVAAVHDTGL
NALPIVALLTFLVGAVVAFLGATVLDDFGATIYTVNLVAFSFLREFGVLLAAILLAGRTA
SAFTAHIGAMKVNEELDAIRTLGLNPIELLVLPRVMAMMVSLPILTFVGMISGMVGGAMV
CALVLDITPTQFMAIVERDIALQHFVVGIVKAPIFAFLIAVIGCLEGFKVAGSAQSVGEH
TTSSVVQSIFMVILLDSIAALFFMEMGW