Protein Info for Psest_1647 in Pseudomonas stutzeri RCH2

Annotation: Lhr-like helicases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 863 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 10 to 817 (808 residues), 1146.3 bits, see alignment E=0 PF00270: DEAD" amino acids 22 to 199 (178 residues), 91.7 bits, see alignment E=1.1e-29 PF04851: ResIII" amino acids 25 to 196 (172 residues), 26 bits, see alignment E=2e-09 PF00271: Helicase_C" amino acids 247 to 354 (108 residues), 46.5 bits, see alignment E=1e-15 PF19306: WH_Lhr" amino acids 381 to 550 (170 residues), 206.8 bits, see alignment E=3.6e-65 PF08494: DEAD_assoc" amino acids 602 to 788 (187 residues), 189.2 bits, see alignment E=1.8e-59

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 92% identity to psa:PST_2663)

Predicted SEED Role

"FIG003033: Helicase domain protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK82 at UniProt or InterPro

Protein Sequence (863 amino acids)

>Psest_1647 Lhr-like helicases (Pseudomonas stutzeri RCH2)
MNDAAGLLSEQWFASREWQPFPFQREVWQAIDRGESGLLHATTGSGKTYAVWLGALNRFA
TKAPRPNTTDKPAPLTVLWITPMRALAADTARALQAPLYDLGINWSIGLRTGDTSGAERA
RQGRRLPSALVTTPESLTLLLTRADARQAFAGLRMLVVDEWHELLGNKRGVQLQLALARL
RQWMPELIVWGLSATLGNQPHALDVLLYPGSGRLVQGKVDKDLRVDTLLPPCIERFPWAG
HLGLRMLPQVVEEIDSAATTLVFTNTRSQSEIWYQALLDARPDWAGLIALHHGSLAREVR
DWVEQGLKQGALKAVVCTSSLDLGVDFLPVERVLQIGSPKGVARLMQRAGRSGHAPGRTS
RVTLVPTHSVEVVEAAAAQVAIGERRIEARSAPHRPLDVLVQHLVSMALGGGFRPDELFA
EVRQAWSYRDLNEDHWQWALAFVRHGGHSLTAYPDYQRVEPDEAGLWKVPSRRVALRHRM
SIGTIVSDASLSVKFWAKGGSGRSLGTIEEGFIARLRPGDNFLFGGRLLELVRVENMTAY
VSRATGRKAAVPRWNGGRMPLSSELADAVVEQLGAASRGHFESPEMGLVEPLLRVQMDWS
ALPTETTLLAEVMKSREGWHLFLYPFAGRHVHLGLASLLAWRLGQHRPLTFSIAVNDYGF
ELLSATEVDWMHWLTPELFSEDNLLHDVLASLNAGELARRRFREIARIAGLVFSGYPGAQ
KSARQLQASSGLFFDVFRQYDPANLLLTQAEEEVLRQELEVERLQQTLQRLQQRQLDIHQ
VKRTTPLAFPLMVERFRESMSSEKLADRIRRMVAELDKAAGPGGYQPQADASIAVERDSS
PKRKPRATKDGTPRPKKARRTTR