Protein Info for PGA1_c16300 in Phaeobacter inhibens DSM 17395

Annotation: dipeptide transport ATP-binding protein DppD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF00005: ABC_tran" amino acids 26 to 182 (157 residues), 84.5 bits, see alignment E=5.4e-28

Best Hits

Swiss-Prot: 46% identical to OPPD_HAEIN: Oligopeptide transport ATP-binding protein OppD (oppD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 87% identity to sit:TM1040_0035)

MetaCyc: 44% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppD (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZF2 at UniProt or InterPro

Protein Sequence (284 amino acids)

>PGA1_c16300 dipeptide transport ATP-binding protein DppD (Phaeobacter inhibens DSM 17395)
MSTLLDVENLWVRFPTRNGIFDAVRGVSFSLGRERLGIVGESGSGKSMTGRAILRLIRHP
GIVEADHINLHGENLLAKSEREMRNVRGEQISMVMQDPKFSLNPVMTIGNQLIEAHRLHS
KSTKAEAYAKALEMLEAVSIRDPERVMTAYPHEMSGGMGQRIMIAMMLIPNPEILIADEP
TSALDVSVQGQVLSIMDRLVKERGMGLIFISHDLNLVSQFCDRVLIMYAGRIVEVCDANR
LHEAQHPYTKGLLGSLPRFDAPRPRLEVLQRDPAWRDAPSVEGR