Protein Info for PGA1_c16260 in Phaeobacter inhibens DSM 17395

Annotation: putative membrane dipeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF01244: Peptidase_M19" amino acids 4 to 344 (341 residues), 317.6 bits, see alignment E=9.3e-99

Best Hits

KEGG orthology group: K01273, membrane dipeptidase [EC: 3.4.13.19] (inferred from 70% identity to sit:TM1040_0039)

Predicted SEED Role

"Microsomal dipeptidase (EC 3.4.13.19)" in subsystem Pyrroloquinoline Quinone biosynthesis (EC 3.4.13.19)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.13.19

Use Curated BLAST to search for 3.4.13.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQK4 at UniProt or InterPro

Protein Sequence (356 amino acids)

>PGA1_c16260 putative membrane dipeptidase (Phaeobacter inhibens DSM 17395)
MTDPLIFDGHNDLLLQLHNRDVSPGKDGFQGDGGRQIDLTKARRGGFSGGFFAIYVPDVV
NIDMHDKMSSDSYDLPLSQEISWSEAAPVALSQAAILYQLERDGALKICRSTNDIRNCLA
NGVMAAVMHMEGAEAIDPDFHMLEVLYQAGLRSLGPVWSRPTRFGHGVPFRFPGSPDTGP
GLTADGKRLVQRCNQLGVMIDLSHLNEAGFWDVAELSDAPLVATHSNAHALTPHSRNLTD
RQLHAIRDSDGMVGLNFAVAFLREDGRMDADTPLDRVLRHIDHLVTHLGEDRVGFGSDFD
GATVPQDIETVAGLPVLRVALRQHGINDALMKKLCHGNWLRVLDATWQNPAKNAGP