Protein Info for Psest_1623 in Pseudomonas stutzeri RCH2

Annotation: Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00160: Pro_isomerase" amino acids 26 to 181 (156 residues), 163 bits, see alignment E=3.4e-52

Best Hits

Swiss-Prot: 69% identical to PPIA_PSEAE: Peptidyl-prolyl cis-trans isomerase A (ppiA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03767, peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC: 5.2.1.8] (inferred from 96% identity to psa:PST_2685)

MetaCyc: 64% identical to peptidyl-prolyl cis-trans isomerase A (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiA precursor (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHG0 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Psest_1623 Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family (Pseudomonas stutzeri RCH2)
MLKRIALAACSLLLAGNLLAAENPRVLLNTSLGEIELELEAEKAPISVENFLGYVDSGFY
DGTVFHRVIPGFMVQGGGFGEGLNQKPTKAPIKNEADNGLHNVRGTVAMARTQNVNSATS
QFFINHRDNDFLDHGSRDFGYAVFAKVVRGMDVVDQIAQVPTGNRATMQNVPLTPVKIIT
AKKL