Protein Info for Psest_1614 in Pseudomonas stutzeri RCH2

Annotation: ABC-type uncharacterized transport system involved in gliding motility, auxiliary component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 585 to 605 (21 residues), see Phobius details PF23357: DUF7088" amino acids 38 to 138 (101 residues), 91.8 bits, see alignment E=2.9e-30 PF09822: ABC_transp_aux" amino acids 176 to 474 (299 residues), 254.3 bits, see alignment E=1.6e-79

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_2694)

Predicted SEED Role

"gliding motility protein GldG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLG1 at UniProt or InterPro

Protein Sequence (611 amino acids)

>Psest_1614 ABC-type uncharacterized transport system involved in gliding motility, auxiliary component (Pseudomonas stutzeri RCH2)
MKRLIYSGAGLLLIALAFLAFNGLSGTLLTNARLDLTEQKLYTISEGTERILDGLQTPIE
LHFFYSDETAKDLVALRNYARRVEEMLKAYQRASGGKLKLHVIDPQPFSEEEDRAAEFGL
QAVPLNQGGDKVYFGLAGTNAEGGTQIIPFFPLDQEEFLEYEISRLVQSLAAGELPVVGV
LSGLQLTGGFDMRTQQATPPWMVLEEVRQLFHIESLRRDVDLIPTNVSVLLLIHPKDLPE
QTLYAIDQFVLRGGKLLVFLDPHSEADPGMGIGPGEFGEERASDLEPLFKAWGVRMVPQR
ALADGAYAMSVGMGAERHPVRHAGWLSLPRSALDQDDVTTAALENITVASAGILEPLEDA
TTRFTPLFSSSEYSMPVEAERFATLDNPETLLLGLEPTGERYTLAARIQGPAKTAFPDGI
EGREKGIQESQNINVIAVADTDMLSDRMWVQVQDFFGQRIPQPWADNGAFVINALDNLSG
TDALISVRSRGRFTRPFVVVEALQRQAENRFREKEEVLQQRLADTEQKLAELQSPDPEQA
LELTAEQEQALRQFMQEKVRIRKELREVRYQLNADIEALGRTLKFANIALVPLVLTLGVL
ALWLWRRRRSA