Protein Info for PGA1_c15950 in Phaeobacter inhibens DSM 17395

Annotation: putative branched-chain amino acid transport system, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 25 (2 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 213 (17 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 353 to 381 (29 residues), see Phobius details amino acids 415 to 433 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 165 to 380 (216 residues), 97.7 bits, see alignment E=3.3e-32

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 80% identity to sit:TM1040_1276)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQI7 at UniProt or InterPro

Protein Sequence (440 amino acids)

>PGA1_c15950 putative branched-chain amino acid transport system, permease protein (Phaeobacter inhibens DSM 17395)
MSETVKTSLLFLFVGVLILLEGSTNFLFFSGSWNSALVILNMGLVSAIMAIGVNLQWGFA
GLFNVGIMGFVALGGLAVVLVSTAPTPGAWSQGGVGIIMALAMGAMTLVAAVATMRMVPA
GKLRIAVLLAVLILGFVVYRAIFDPAVAGVEAINPALEGNLGGLGLPVLLAWPAGGLLAA
GVAWLIGKTALGLRSDYLAIATLGIAEIIISVLKNEDWLSRGVKNVVGLPRPLPYEVDLQ
NDAAFAAKAADYGLDPVLASTLYVKLGYSLLFTVVLLALLWMAQMALKSPWGRMMRAIRD
NEVAAEAMGKDVTRRHLQIFILGSAICGIAGAMMTTLDSQLTPGTYNPLRFTFLIWVMVI
VGGSGNNFGAVLGGLLIWFLWIKVEPMGILLIETLTAGMADTNALKVHLLESASHMRLLT
MGLILLLVLRFSPRGLIPER