Protein Info for Psest_1607 in Pseudomonas stutzeri RCH2

Annotation: Acetyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF00583: Acetyltransf_1" amino acids 39 to 119 (81 residues), 56.2 bits, see alignment E=6.2e-19 PF13673: Acetyltransf_10" amino acids 45 to 127 (83 residues), 42.4 bits, see alignment E=1e-14 PF13508: Acetyltransf_7" amino acids 48 to 121 (74 residues), 57.2 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: K03826, putative acetyltransferase [EC: 2.3.1.-] (inferred from 56% identity to vsp:VS_II0525)

Predicted SEED Role

"Probable acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK45 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Psest_1607 Acetyltransferases (Pseudomonas stutzeri RCH2)
MIRPCRPADLETVLNIWLEASSGAHDFVARSFWEARLDDMRNLYLPAAQTWVHEQDGTVV
GFVSLVDDTLAAIFVAPTEQGCGIGSALLEHAKRQRERLSLTVYAANEASIAFYLRHGFQ
VAGEQLDEHTGHTELAMIWQPQAPVAGGAGSLSSS