Protein Info for PGA1_c15820 in Phaeobacter inhibens DSM 17395

Annotation: putative phenylacetic acid degradation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF14602: Hexapep_2" amino acids 71 to 103 (33 residues), 30 bits, see alignment 3.5e-11 amino acids 108 to 120 (13 residues), 15.5 bits, see alignment (E = 1.1e-06) PF00132: Hexapep" amino acids 73 to 104 (32 residues), 36 bits, see alignment 3.8e-13 amino acids 88 to 122 (35 residues), 42.6 bits, see alignment 3.1e-15

Best Hits

Swiss-Prot: 57% identical to Y3753_PSEAE: Uncharacterized protein PA3753 (PA3753) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 84% identity to sit:TM1040_1265)

MetaCyc: 37% identical to 2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E0S6 at UniProt or InterPro

Protein Sequence (173 amino acids)

>PGA1_c15820 putative phenylacetic acid degradation protein (Phaeobacter inhibens DSM 17395)
MTIYALGDKTPELHADTWVAPDANLIGLVVLEERASVWFGSTIRADHEEIRIGRGSNVQE
NCVMHIDAGYPLTIGENCTIGHKVMLHGCTIGDNSLIGMGATVLNGAKIGKNCLIGAGAL
ITENKEIPDNSLVMGAPGKIVRDVDEALVQSLRQSAEHYQENMRRFRDELTEV